cinemaworldmovies.com is providing you free access to all the latest movies for free. You can get every movie here for free.

1.67 Rating by ClearWebStats
cinemaworldmovies.com is 7 years 1 month 2 weeks old. This website has a #409,402 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 5,760.00 and has a daily earning of $ 16.00. While no active threats were reported recently by users, cinemaworldmovies.com is SAFE to browse.
Get Custom Widget

Traffic Report of Cinemaworldmovies

Daily Unique Visitors: 1,763
Daily Pageviews: 5,289

Estimated Valuation

Income Per Day: $ 16.00
Estimated Worth: $ 5,760.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 409,402
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
81
Siteadvisor Rating
View cinemaworldmovies.com site advisor rating Not Applicable

Where is cinemaworldmovies.com server located?

Hosted IP Address:

198.252.106.234 View other site hosted with cinemaworldmovies.com

Hosted Country:

cinemaworldmovies.com hosted country US cinemaworldmovies.com hosted country

Location Latitude:

34.0522

Location Longitude:

-118.244

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View cinemaworldmovies.com HTML resources

Homepage Links Analysis

Cinema World Movies
2000 to 2011 hd movies, 2012 hd movies, 2013 hd movies, 2014 hd movies, 2015 hd movies, 2016 hd movies, 2017 hd movies, action movies, adventure movies, animated movies, best hd movies, best scary movies, bollywood, click here to download, comedy movies, dmca, drama movies, dual audio, fantasy movies, fever 2016 1080p webhd x265 750mb, hd movies, hindi dubbed, hindi dubbed dual audio movies, hollywood, home, horror movies, like and share on facebook, main aur charles 2015 720p hdrip 700mb, menu, mubarakan 2017 hdts 700mb, new, new movies, pin it, request, romantic movies, sci fi movies, thriller movies, tweet, yearly, d.moretext t, w, 2016, 2017, agustus, anime, beranda, blog archives, blogger, coraline subtitle indonesia, desember, doraemon nobita and the green giant legend sub indo, download, download anime dan film kartun terbaru terpopuler di tv, download kartun larva full episode 1 104, februari, file download yang terkait, film kartun, film kartun barbie, finding dory subtitle indonesia, finding nemo subtitle indonesia, frozen fever 2015 subtitle indonesia, hell and back subtitle indonesia, januari, juli, justice league vs teen titans subtitle indonesia, lego scooby doo blowout beach bash subtitle indo..., lego scooby doo haunted hollywood subtitle indo..., list cartoon, magical doremi episode 1 51, maret, mei, november, oktober, pokemon the movie volcanion and mechanical marvel..., popular, posting lama, request lapor link, robocar poli tv series full episode season 1 3 ..., september, tags, tamiya let s go episode 1 51 dub indonesia, the good dinosaur subtitle indonesia, the lego batman movie 2017 subtitle indonesia, tokusatsu, turbo subtitle indonesia, video masha and the bear full episode bluray subtitle indonesia, zootopia 2016 subtitle indonesia, 3, 4, anime list, bkdroid v 3.6.13, bknime, bukan anime fansub, cara download, download streaming, ethayu, faq, follow bknime, high school dxd new, kagaku na yatsura, konbini kareshi, monster musume no iru nichijou bd, prison school bd, relawan, rescue me, seikon no qwaser, share, slice of life, social magazine, sword art online ova 3, alice through the looking glass 2016 7..., diablo 2015 1080p bluray x265 450mb, yeh dil aashiqanaa 2002 480p dvdscr 45..., comedy, gamers, romance, school, 123movies, 2012 movies, 2013 movies, 2014, 2014 movies, 2015 movies, 2016 movies, 2017 movies, action, adventure, afdah, animation, biography, blog, click here to cancel reply., cokeandpopcorn, cokepopcorn, contact us, crime, documentary, download going in style 2017, download movies free, download person to person 2017, download the incredible jessica james hd movie point, download the incredible jessica james openload movie, download the incredible jessica james putlocker movie, download the incredible jessica james sd movie point, download the wall 2017, drama, english, family, fantasy, foreign, free movies, free wordpress themes, full movie free download, fullmoviesfreedownload, hd movie counter, hdmoviespoint, hdpopcorns, hindi, history, horror, how to download movies, leave a response, losmovies, magazine wordpress themes, megashare9, movieflixter, music, mystery, openload movies, punjabi movie, report, romantic, sci fi, skstream, sokrostream, solarmovie, sports, tehparadox, the incredible jessica james 2017, thriller, todotorrents, trackback, trailer, tweet to fullmoviesfree2, uncategorized, war, western, wordpress themes 2013, world4ufree, 16 blocks 2006 dual audio 720p bluray ..., maleficent 2014 720p bluray 700mb, offspring 2009 480p dvdscr 300mb, ecchi, hajimete no gal, shounen, yami shibai s5 subtitle indonesia episode 05, sin nanatsu no taizai, 2009 kebawah, 2010, 2011, 2012, 2013, 2015, alien covenant 2017 bluray 720p indo subtitle, artikel terkait, baahubali 2 the conclusion 2017 bluray 720p indo subtitle, bluray, bolywood, boxoffice, boyka undisputed vi 2016 bluray 720p indo subtitle, daftar film, download film terbaru, edge of tomorrow 2014 bluray 720p indo subtitle, forgot your password get help, genre, imdb, lebih dari penulis, maze runner 2 the scorch trials 2015 bluray 720p indo subtitle, rafsanzani, tahun, the mummy 2017 web dl 720p indo subtitle, the wall 2017 web dl 720p indo subtitle, tonight she comes 2016 bluray 720p indo subtitle, web dl, 0 comment, agustus 2012, agustus 2013, agustus 2014, agustus 2015, agustus 2016, agustus 2017, aguswarteg, android, anime detektiv conan, april 2012, april 2013, april 2014, april 2015, april 2016, april 2017, artikelku, batalkan balasan, blog film full movie, cara agar subtitle muncul di film, cara download di media1fire, cara lewati sh.st via opera mini, cara lewati sht.io, copas, desember 2012, desember 2013, desember 2014, desember 2015, desember 2016, download film full movie film hollywood mandarin korea tv series, februari 2012, februari 2013, februari 2014, februari 2015, februari 2016, februari 2017, fight for space 2017 web dl subtitle indonesia, fighter of the destiny episode 01 18 subtitle indonesia, film full movie, film full movie 2014, film full movie 2015, film full movie 2016, film full movie 2017, film full movie 720p, film full movie action, film full movie adventure, film full movie animasi, film full movie bollywood, film full movie drama, film full movie hollywood, film full movie horor, film full movie horor indonesia, film full movie indonesia, film full movie indonesia 2013, film full movie indonesia 2014, film full movie indonesia 2015, film full movie indonesia lama, film full movie islami, film full movie klasik, film full movie komedi, film full movie korea, film full movie romance, film full movie sci fi, film full movie thriller, film pengetahuan, film sang pencerah full movie, film syrup 2013 bluray subtitle indonesia, iconic one, indonesia, internet gratis, januari 2012, januari 2013, januari 2014, januari 2015, januari 2016, januari 2017, juli 2012, juli 2013, juli 2014, juli 2015, juli 2016, juli 2017, juni 2012, juni 2013, juni 2014, juni 2015, juni 2016, juni 2017, killing ground 2017 subtitle indonesia, kontes seo, lego scooby doo blowout beach bash 2017 hdrip subtitle indonesia, maret 2013, maret 2014, maret 2015, maret 2016, maret 2017, mei 2012, mei 2013, mei 2014, mei 2015, mei 2016, mei 2017, movie collection, november 2011, november 2012, november 2013, november 2014, november 2015, november 2016, oktober 2012, oktober 2013, oktober 2014, oktober 2015, oktober 2016, other, outlander subtitle indonesia, pendekar kelana swordsman 2013, romance of the condor heroes 2014, romansa, s.w.a.t under siege 2017 bluray subtitle indonesia, september 2013, september 2014, september 2015, september 2016, seri serial silat, server 1, server 2, server 3, skip to content, tentang banyaknya iklan spam di blog ini, the flowers of war 2011 bluray subtitle indonesia, the flowers of war 2011 subtitle indonesia, the flowers of war aka jin ling shi san chai, the levelling 2017 hdrip subtitle indonesia, the wall 2017 web dl subtitle indonesia, tv series, war for the planet of the apes 2017 hdts subtitle indonesia, warkop dki setan kredit, widget mwb, wordpress, download film june 2015 bluray subtitle indonesia, film coraline 2009 bluray subtitle indonesia, film kamar 207 2014 mp4 full movie, flowers of war 2011 bluray subtitle indonesia, kungfu panda 3 2016 bluray subtitle indonesia, server 4, she who must burn 2016 hdrip subtitle indonesia, the darkness, 480p, apes, backtrack 2016 hdrip subtitle indonesia, film hantu pohon boneka 2014 dvdrip full movie, film lady of the dinasty 2015 hdrip subtitle indonesia, iboy 2017 web dl subtitle indonesia, mp4, planet, powered by wordpress, sub indo, theme by seos, war for the planet of the apes, war for the planet of the apes 2017 subtitle indonesia, we are the millers 2013 bluray subtitle indonesia, death race 2008 bluray subtitle indonesia, dukung mr.arvind hapus blog porno, facebook, fences 2016 web dl subtitle indonesia, film dragons of camelot 2014 bluray subtitle indonesia, film full movie hungry ghost ritual 2014 sub indonesia, google, the levelling, twitter, war machine 2017 hdrip subtitle indonesia, 720p, admin, atomic blonde 2017 movie dvdrip hd free download, challenge games korean movie, chronichle of the ghostly tribe movie in hindi download, cliti semi movie download, contact, disclaimer, download film layar biru, download young mother 4 sub indo mp4, everything everything 2017 movie free download 720p bluray, filmsemi168 website com, fucking berlin full movieconter, how to be a latin lover 2017 movie 720p bluray 900mb, layar kaca 21 semi, layar kaca 21 semi blue, layar sexmovie, lk21 jav, lk21 mother porn, lk21 porno jepang, lk21subindo, nonton film paprika 1991 sub indo, pencuri movie rock bro, privacy policy, request movie, semitv net, sinopsis film italian race, sinopsis the hospital 2, sitemap, subtitles tinto brass movie indo, the mummy 2017 movie 720p web dl free download, watch online via openload, wish upon 2017 full movie download free hd cam, 360p, bangkitnya suster gepeng 2012 dvdrip mp4, film my wife is a gangster 3 sub indo, film spongebob the movie sponge out of water 2015 bluray subtitle indonesia, film the cabin in the woods 2012 bluray subtitle indonesia film full movie gratis, ghost ship 2002 sub indonesia, ground, hdrip, howard lovecraft and the frozen kingdom 2016 bluray subtitle indonesia, killing, killing ground, the devil complex 2016 dvdrip mp4, the invisible guest 2017 bluray subtitle indonesia, doraemon nobita and the island of miracles animal adventure sub indo

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 20
H3 Headings: Not Applicable H4 Headings: 4
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 18
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 198.252.106.234)

403: Access Forbidden

cinemaworldmovies.com favicon - heylinkit.com

View cinemaworldmovies.com Pagerank   cinemaworldmovies.com alexa rank Not Applicable   cinemaworldmovies.com website value $ 8.95

Melones Old Movies

cinemaworldmovies.com favicon - melonesoldmovies.com

Free Download Classic Old Movies

View cinemaworldmovies.com Pagerank   cinemaworldmovies.com alexa rank Not Applicable   cinemaworldmovies.com website value $ 8.95

Shop -

cinemaworldmovies.com favicon - customtshirtscheap.com

View cinemaworldmovies.com Pagerank   cinemaworldmovies.com alexa rank Not Applicable   cinemaworldmovies.com website value $ 8.95

Ebooks For Easy Life – Ebooks For Easy Life

cinemaworldmovies.com favicon - ebooksforeasylife.com

View cinemaworldmovies.com Pagerank   cinemaworldmovies.com alexa rank Not Applicable   cinemaworldmovies.com website value $ 8.95

Home and Kitchen Appliances Review

cinemaworldmovies.com favicon - homeandkitchenappliancesreview.com

Ultimate Guide to Buy Home and Kitchen Appliances - Reviews and Comparison

View cinemaworldmovies.com Pagerank   cinemaworldmovies.com alexa rank Not Applicable   cinemaworldmovies.com website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: public, max-age=0
Expires: Fri, 04 Aug 2017 20:01:23 GMT
Last-Modified: Fri, 04 Aug 2017 19:31:44 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 20444
Content-Encoding: gzip
Vary: Accept-Encoding,Accept-Encoding
Date: Fri, 04 Aug 2017 20:01:23 GMT
Accept-Ranges: bytes
Server: LiteSpeed
Connection: close

Domain Information for cinemaworldmovies.com

Domain Registrar: NAMECHEAP INC. cinemaworldmovies.com registrar info
Registration Date: 2017-02-23 7 years 1 month 2 weeks ago
Last Modified: 2017-02-25 7 years 1 month 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns13.hawkhost.com cinemaworldmovies.com name server information 198.252.96.160 cinemaworldmovies.com server is located in United States United States
ns14.hawkhost.com cinemaworldmovies.com name server information 198.252.97.160 cinemaworldmovies.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
cinemaworldmovies.com A 14400 IP:198.252.106.234
cinemaworldmovies.com NS 86400 Target:ns14.hawkhost.com
cinemaworldmovies.com NS 86400 Target:ns13.hawkhost.com
cinemaworldmovies.com SOA 86400 MNAME:ns13.hawkhost.com
RNAME:server.hawkhost.com
Serial:2017022503
Refresh:86400
Retry:7200
Expire:2419200
cinemaworldmovies.com MX 14400 Target:cinemaworldmovies.com
cinemaworldmovies.com TXT 14400 TXT:v=spf1 +a +mx +ip4:198.252.106.85
+include:_spf.arandomserver.com ~all

Similarly Ranked Websites to Cinemaworldmovies

En ligne

cinemaworldmovies.com favicon - enligne.fr

En ligne Questions à se poser avant de choisir son Bac+5 Avec le système LMD (Licence - Master - Doctorat), le master est scindé en 2, ce qui don...

View cinemaworldmovies.com Pagerank   Alexa rank for cinemaworldmovies.com 409,403   website value of cinemaworldmovies.com $ 5,760.00

Zaintech Technologies

cinemaworldmovies.com favicon - soft-reseller.com

View cinemaworldmovies.com Pagerank   Alexa rank for cinemaworldmovies.com 409,403   website value of cinemaworldmovies.com $ 5,760.00

Welcome!

cinemaworldmovies.com favicon - blogshop.org

View cinemaworldmovies.com Pagerank   Alexa rank for cinemaworldmovies.com 409,403   website value of cinemaworldmovies.com $ 5,760.00

NOW Vistos - DESPACHANTE DE VISTO AMERICANO | Visto Americano | Visto EUA | Visto USA | Despachante visto EUA | Visto Americano | Como tirar visto americano

cinemaworldmovies.com favicon - solicitandovistoamericano.com

Despachante de Visto Americano líder em aprovação, com a melhor orientação "caso à caso" do Brasil. ATENDEMOS TODAS CIDADES DO BRASIL!

View cinemaworldmovies.com Pagerank   Alexa rank for cinemaworldmovies.com 409,404   website value of cinemaworldmovies.com $ 5,760.00

Under Construction

cinemaworldmovies.com favicon - cpsociety.net

View cinemaworldmovies.com Pagerank   Alexa rank for cinemaworldmovies.com 409,405   website value of cinemaworldmovies.com $ 5,760.00

Full WHOIS Lookup for cinemaworldmovies.com

Domain Name: CINEMAWORLDMOVIES.COM
Registry Domain ID: 2099928968_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2017-02-25T15:14:58Z
Creation Date: 2017-02-23T17:19:09Z
Registry Expiry Date: 2018-02-23T17:19:09Z
Registrar: NameCheap Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS13.HAWKHOST.COM
Name Server: NS14.HAWKHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-04T20:01:19Z