Web stats for Cinemaworldmovies - cinemaworldmovies.com
cinemaworldmovies.com is providing you free access to all the latest movies for free. You can get every movie here for free.
1.67 Rating by ClearWebStats
cinemaworldmovies.com is 7 years 2 months 2 weeks old. This website has a #409,402 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 5,760.00 and has a daily earning of $ 16.00. While no active threats were reported recently by users, cinemaworldmovies.com is SAFE to browse.
Traffic Report of Cinemaworldmovies
Daily Unique Visitors: | 1,763 |
Daily Pageviews: | 5,289 |
Estimated Valuation
Income Per Day: | $ 16.00 |
Estimated Worth: | $ 5,760.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 409,402 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
81
Siteadvisor Rating
Not Applicable
Where is cinemaworldmovies.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 20 |
H3 Headings: | Not Applicable | H4 Headings: | 4 |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 18 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 198.252.106.234)
Home and Kitchen Appliances Review
- homeandkitchenappliancesreview.com
Ultimate Guide to Buy Home and Kitchen Appliances - Reviews and Comparison
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: public, max-age=0
Expires: Fri, 04 Aug 2017 20:01:23 GMT
Last-Modified: Fri, 04 Aug 2017 19:31:44 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 20444
Content-Encoding: gzip
Vary: Accept-Encoding,Accept-Encoding
Date: Fri, 04 Aug 2017 20:01:23 GMT
Accept-Ranges: bytes
Server: LiteSpeed
Connection: close
Status-Code: 200
Status: 200 OK
Cache-Control: public, max-age=0
Expires: Fri, 04 Aug 2017 20:01:23 GMT
Last-Modified: Fri, 04 Aug 2017 19:31:44 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 20444
Content-Encoding: gzip
Vary: Accept-Encoding,Accept-Encoding
Date: Fri, 04 Aug 2017 20:01:23 GMT
Accept-Ranges: bytes
Server: LiteSpeed
Connection: close
Domain Information for cinemaworldmovies.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
cinemaworldmovies.com | A | 14400 |
IP:198.252.106.234 |
cinemaworldmovies.com | NS | 86400 |
Target:ns14.hawkhost.com |
cinemaworldmovies.com | NS | 86400 |
Target:ns13.hawkhost.com |
cinemaworldmovies.com | SOA | 86400 |
MNAME:ns13.hawkhost.com RNAME:server.hawkhost.com Serial:2017022503 Refresh:86400 Retry:7200 Expire:2419200 |
cinemaworldmovies.com | MX | 14400 |
Target:cinemaworldmovies.com |
cinemaworldmovies.com | TXT | 14400 |
TXT:v=spf1 +a +mx +ip4:198.252.106.85 +include:_spf.arandomserver.com ~all |
Similarly Ranked Websites to Cinemaworldmovies
En ligne
- enligne.fr
En ligne Questions à se poser avant de choisir son Bac+5 Avec le système LMD (Licence - Master - Doctorat), le master est scindé en 2, ce qui don...
NOW Vistos - DESPACHANTE DE VISTO AMERICANO | Visto Americano | Visto EUA | Visto USA | Despachante visto EUA | Visto Americano | Como tirar visto americano
- solicitandovistoamericano.com
Despachante de Visto Americano líder em aprovação, com a melhor orientação "caso à caso" do Brasil. ATENDEMOS TODAS CIDADES DO BRASIL!
Full WHOIS Lookup for cinemaworldmovies.com
Domain Name: CINEMAWORLDMOVIES.COM
Registry Domain ID: 2099928968_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2017-02-25T15:14:58Z
Creation Date: 2017-02-23T17:19:09Z
Registry Expiry Date: 2018-02-23T17:19:09Z
Registrar: NameCheap Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS13.HAWKHOST.COM
Name Server: NS14.HAWKHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-04T20:01:19Z
Registry Domain ID: 2099928968_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2017-02-25T15:14:58Z
Creation Date: 2017-02-23T17:19:09Z
Registry Expiry Date: 2018-02-23T17:19:09Z
Registrar: NameCheap Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS13.HAWKHOST.COM
Name Server: NS14.HAWKHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-04T20:01:19Z